DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG18735

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:244 Identity:92/244 - (37%)
Similarity:141/244 - (57%) Gaps:21/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVK 81
            |.::.:|  .|||||...::...|:::.:..:|..:||.|::|:...|||.||:||..|||:.|:
  Fly    74 CGNINTR--HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVR 136

  Fly    82 VGGTSRYRKDGELFSVADLQV-----HENFNPKTMDYDIGIIRLTKNLTLSRKVKAI--PINPER 139
            :  ....|:|..: .:.|.:|     |..::.:..|.||.:||..:.:.|...:..:  |...|.
  Fly   137 L--LEHNRQDSHV-KIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSEN 198

  Fly   140 VAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNL-LGKT-VTDRMLCAGYL-KGGTDA 201
            .| |..|.:.|||..|..||.||:|:...|||::|..|||. .|:: :||.|:||||: :||.|:
  Fly   199 YA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS 262

  Fly   202 CQMDSGGPLSV-----REQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            ||.|||||:.|     ..||.||||||.|||..:.||||:|:.:.:.|:
  Fly   263 CQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 89/231 (39%)
Tryp_SPc 28..248 CDD:238113 89/233 (38%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/232 (38%)
Tryp_SPc 83..314 CDD:238113 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.