DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG34458

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:247 Identity:88/247 - (35%)
Similarity:143/247 - (57%) Gaps:7/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLS-LESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72
            :|||..:...| ::...:.||:||..|.....|:.||:||.|.||||||:|::..|:||.||..|
  Fly    12 ILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMG 76

  Fly    73 VPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPI-- 135
            .....:|..||.......:|:.|::|...:|..:||::.|:|:.:|:|:..:.:...|:.|.:  
  Fly    77 QNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLAD 141

  Fly   136 NPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTAC--RNLLGKTVTDRMLCAGYLKGG 198
            :....|..|.|.|:|:|..:.|....:.|::|:|.:.::..|  :|:.|  :||||:|||:..|.
  Fly   142 SDSNYAADTMAMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG--LTDRMVCAGHPSGQ 204

  Fly   199 TDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLN 250
            ..:||.||||||:|..:|.|:||||.||....:|.:|:.:.||..|:.|..|
  Fly   205 VSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNAN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 81/220 (37%)
Tryp_SPc 28..248 CDD:238113 81/223 (36%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 81/221 (37%)
Tryp_SPc 32..254 CDD:238113 81/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.