DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and AZU1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:238 Identity:70/238 - (29%)
Similarity:109/238 - (45%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGG-- 84
            |.|...||||..|.....|::.|||..|.|.|||::|:...::||..|.......:..|.:|.  
Human    21 SSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYD 85

  Fly    85 -TSRYRKDGELFSVADLQVHEN-FNPKTMDYDIGIIRLTK--NLTLSRKVKAIPINPERVAEGTY 145
             ..|.|:..:.||::.:.  || ::|:....|:.:::|.:  |||.|..:..:|:....|..||.
Human    86 LRRRERQSRQTFSISSMS--ENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTR 148

  Fly   146 ATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYL--KGGTDACQMDSGG 208
            ..:||||.:...|..|...|:..|.:..:..||        ...:|.|.|  :||  .|..|.|.
Human   149 CQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCR--------PNNVCTGVLTRRGG--ICNGDGGT 203

  Fly   209 PLSVREQLVGIVSWGVG-CALADKPGVYSRLDALHPWLDQVLN 250
            ||.......|:.|:.:| |...  |..::|:.....|:|.|||
Human   204 PLVCEGLAHGVASFSLGPCGRG--PDFFTRVALFRDWIDGVLN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 63/225 (28%)
Tryp_SPc 28..248 CDD:238113 65/228 (29%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 64/226 (28%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.