DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and PRSS8

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:263 Identity:86/263 - (32%)
Similarity:134/263 - (50%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQASGCLSLES----RPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCL 70
            ||...:|....|:    .|..||.||..|.....|:.|||...|:|.||||:::...:|:|.||.
Human    23 LLRSGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCF 87

  Fly    71 NGVPHR-LLKVKVGG--TSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKA 132
            ....|: ..:||:|.  ...|.:|.::.::.|:..|.::..:....||.:::|::.:|.||.::.
Human    88 PSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRP 152

  Fly   133 I--PINPERVAEGTYATIAGWGFKSMNGPPSDS------LRYARVPIVNQTACR---NLLGKT-- 184
            |  |........|.:.|:.|||..:    ||.|      |:...||::::..|.   |:..|.  
Human   153 ICLPAANASFPNGLHCTVTGWGHVA----PSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEE 213

  Fly   185 ---VTDRMLCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRLDALH 242
               |.:.|:||||::||.||||.|||||||...:    |.||||||..|...::||||:...:..
Human   214 PHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYA 278

  Fly   243 PWL 245
            .|:
Human   279 SWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 80/239 (33%)
Tryp_SPc 28..248 CDD:238113 80/241 (33%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 80/240 (33%)
Tryp_SPc 45..284 CDD:238113 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.