DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:187 Identity:61/187 - (32%)
Similarity:88/187 - (47%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPER--VAEGTYA 146
            ||.:|.|...|..      |..:|..|.:.||.:|:|:..:.|:|.|...|:..:.  :..|...
Zfish    18 GTEQYSKPLMLIP------HPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQNTGLLAGRMC 76

  Fly   147 TIAGWGFKSMNGP--PSDSLRYARVPIVNQTACR--NLLGKTVTDRMLCAGYLKGGTDA------ 201
            .::|||..|.:|.  |. :||..|:|||:...|.  :.....:|..|:|||...||.||      
Zfish    77 RVSGWGSTSHSGGLIPL-TLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDACKNSTQ 140

  Fly   202 ---------CQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
                     ||.||||||....::.|:||||.||.....||||:.:.....|:||.:
Zfish   141 YLCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWIDQTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 58/180 (32%)
Tryp_SPc 28..248 CDD:238113 60/184 (33%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 60/184 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.