DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and PRSS2

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:254 Identity:81/254 - (31%)
Similarity:137/254 - (53%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCL--- 70
            |:|...:..::.....|.:||||:..:..::||.||:. .|.|.||||:|:...:::||||.   
Human     5 LILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLN-SGYHFCGGSLISEQWVVSAGHCYKSA 68

  Fly    71 -------NGVPHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTL 126
                   .|..:..::|::|..:....:|  :..:.|.:..|..:|.:|:|.||.:|:|:....:
Human    69 INSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVI 133

  Fly   127 SRKVKAIPINPERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRNLLGKTVTDRML 190
            :.:|.||.:.....|.||.:.|:|||....:|.. .|.|:....|:::|..|.......:|:.|.
Human   134 NSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMF 198

  Fly   191 CAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            |.|:|:||.|:||.|||||:....:|.||||||.|||..::||||:::.....|:...:
Human   199 CVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/229 (34%)
Tryp_SPc 28..248 CDD:238113 78/232 (34%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 77/230 (33%)
Tryp_SPc 24..256 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.