DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and PRSS1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:244 Identity:81/244 - (33%)
Similarity:133/244 - (54%) Gaps:8/244 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |:|...:..|:.....|.:||||:..:..::||.||:. .|.|.||||:||...:::||||... 
Human   230 LILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHCYKS- 292

  Fly    74 PHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPIN 136
               .::|::|..:....:|  :..:.|.:..|..::.||::.||.:|:|:....::.:|..|.:.
Human   293 ---RIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLP 354

  Fly   137 PERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTD 200
            ....|.||...|:|||..:.:|.. .|.|:....|:::|..|.......:|..|.|.|:|:||.|
Human   355 TAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKD 419

  Fly   201 ACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            :||.|||||:....||.|:||||.|||..:|||||:::.....|:...:
Human   420 SCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 76/219 (35%)
Tryp_SPc 28..248 CDD:238113 77/222 (35%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 76/220 (35%)
Tryp_SPc 249..467 CDD:238113 77/222 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.