DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:262 Identity:96/262 - (36%)
Similarity:138/262 - (52%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLE----SRPD---PRIVGGFPADIANIPYIVSIQ-LYGIHHCGGSIINNHTILT 65
            ||||    |:.||    |..|   .|||||:.....:|.|||||| ..|.|.|||::||.:.:||
Zfish     5 LLLL----CVLLEILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLT 65

  Fly    66 AGHCLNGVPHRLLKVKVG--------GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTK 122
            |.||..|..:  :::..|        |..::|:...|..      |..::..|.:.||.:|:|..
Zfish    66 AAHCNIGEAN--MRIVAGDYSVGLYEGMEQFRRPHMLIP------HPQYDRSTNNADIMLIKLQS 122

  Fly   123 NLTLSRKVKAIPINPER---VAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACR--NLLG 182
            .:.|:..|..:|: |.:   ||.|...:::||||.:..|..|..||..::|||:...|.  :...
Zfish   123 PVYLNSYVSLVPL-PRQDAMVAVGRLCSVSGWGFTTSTGGISSILRTVKLPIVSTAVCNGTDSFN 186

  Fly   183 KTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQ 247
            ..:|:.|:||||..||.|||:.||||||....::.||||||.|||.|..||||:.:.....|:|.
Zfish   187 GNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQFRQWIDA 251

  Fly   248 VL 249
            .:
Zfish   252 TI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 85/230 (37%)
Tryp_SPc 28..248 CDD:238113 86/233 (37%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 85/231 (37%)
Tryp_SPc 27..252 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.