DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and KLK15

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:263 Identity:74/263 - (28%)
Similarity:133/263 - (50%) Gaps:22/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWWKLLLLQASGCLSLESRPD-PRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGH 68
            :|   |||..|..|:..:..| .:::.|......:.|:.|::...|..:||.|:|:.|.:|:|.|
Human     1 MW---LLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAH 62

  Fly    69 CLNGVPHRLLKVKVGGTSRYRKDG--ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK 131
            |.:    |.::|::|..:..::||  :|.:.:.:..|..:..::...||.::||.:...|:.:|:
Human    63 CQS----RFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVR 123

  Fly   132 AIPINPERVAEGTYATIAGWGFKSMNGPPS-----------DSLRYARVPIVNQTACRNLLGKTV 185
            ...:.......|....::|||..|.|.|.:           |:|..|.:.|::.|:|.......:
Human   124 PAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRL 188

  Fly   186 TDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWG-VGCALADKPGVYSRLDALHPWLDQVL 249
            |:.|:|||....|.::|:.||||||.....|.|||||| |.|....|||||:::.....|:.:.:
Human   189 TNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRETM 253

  Fly   250 NKS 252
            .::
Human   254 KRN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 66/230 (29%)
Tryp_SPc 28..248 CDD:238113 67/233 (29%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.