DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and prss1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:250 Identity:84/250 - (33%)
Similarity:135/250 - (54%) Gaps:24/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGV 73
            |:||.|:  ::.|.  |.:|||||......:||.||:.. |.|.||||:||:..:::|.||... 
 Frog     7 LVLLGAA--VAFED--DDKIVGGFTCTKNAVPYQVSLNA-GYHFCGGSLINSQWVVSAAHCYKS- 65

  Fly    74 PHRLLKVKVG--------GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKV 130
               .::|::|        ||.::.:..::..      |.::|.:.:|.||.:|:|:....||..:
 Frog    66 ---RIQVRLGEHNIAVNEGTEQFIESQKVIK------HPSYNSRNLDNDIMLIKLSTTARLSSNI 121

  Fly   131 KAIPINPERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGY 194
            :::|:.....:.||...|:|||....:|.. .|.|:....||:..:.|.|.....:|:.|.|||:
 Frog   122 QSVPLPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSNSYPGEITNNMFCAGF 186

  Fly   195 LKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            |.||.|:||.|||||:....||.|:||||.|||..:.||||:::.....|:...:
 Frog   187 LAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/225 (34%)
Tryp_SPc 28..248 CDD:238113 78/228 (34%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 78/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.