DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tpsab1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:277 Identity:90/277 - (32%)
Similarity:133/277 - (48%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLL---------QASGCLSLESRPDPRIVGGFPADIANIPYIVSIQL---YGIHHCGGSIINN 60
            |||||         .|:..|::   |...||||..|.....|:.||:::   |.:|.||||:|:.
  Rat    40 KLLLLTLPLLSSLVHAAPSLAM---PREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHP 101

  Fly    61 HTILTAGHCL--NGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKN 123
            ..:|||.||:  |......|:|::.....|..| .|.:|:.:..|.:|.......||.:::||..
  Rat   102 QWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHD-HLLTVSQIISHPDFYIAQDGADIALLKLTNP 165

  Fly   124 LTLSRKVKAIPINP--ERVAEGTYATIAGWGFKSMNG----PPSDSLRYARVPIVNQTACRNLLG 182
            :.::..|..:.:.|  |....||...:.|||  ::|.    ||...|...:||||....|.....
  Rat   166 VNITSNVHTVSLPPASETFPSGTLCWVTGWG--NINNDVSLPPPFPLEEVQVPIVENRLCDLKYH 228

  Fly   183 K---------TVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGV 234
            |         .|.|.|||||  ..|.|:||.||||||..:.:    ..|:||||.|||..::||:
  Rat   229 KGLNTGDNVHIVRDDMLCAG--NEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGI 291

  Fly   235 YSRLDALHPWLDQVLNK 251
            |:|:.....|:.:.:.|
  Rat   292 YTRVTYYLDWIYRYVPK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 80/240 (33%)
Tryp_SPc 28..248 CDD:238113 81/243 (33%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 80/240 (33%)
Tryp_SPc 66..302 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.