DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Elane

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:232 Identity:67/232 - (28%)
Similarity:109/232 - (46%) Gaps:24/232 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGG--TSRYRK 90
            ||||.||.....|::.|:|..|.|.||.::|..:.:::|.||:||:..|.::|.:|.  ..|..:
Mouse    29 IVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQER 93

  Fly    91 DGELFSVADLQVHEN-FNPKTMDYDIGIIRLTKNLTLSRKVKA--IPINPERVAEGTYATIAGWG 152
            ..:.|||.  ::.|| |:|..:..||.||:|..:.|::..|:.  :|...:.|.:.|.....|||
Mouse    94 TRQTFSVQ--RIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWG 156

  Fly   153 FKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRM---LCAGYLKGGTDACQMDSGGPLSVRE 214
            ....|.|....|:...|.:|.....|.:...|:..|.   :|.|           ||||||....
Mouse   157 RLGTNRPSPSVLQELNVTVVTNMCRRRVNVCTLVPRRQAGICFG-----------DSGGPLVCNN 210

  Fly   215 QLVGIVSW--GVGCALADKPGVYSRLDALHPWLDQVL 249
            .:.||.|:  | ||.....|..::.:.....|::.::
Mouse   211 LVQGIDSFIRG-GCGSGLYPDAFAPVAEFADWINSII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 66/225 (29%)
Tryp_SPc 28..248 CDD:238113 67/229 (29%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 66/226 (29%)
Tryp_SPc 29..245 CDD:238113 67/229 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.