DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss53

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:292 Identity:68/292 - (23%)
Similarity:112/292 - (38%) Gaps:76/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLL---KVKVGGT 85
            |:|:.....|.:   .|:..|::..|:|.|.||::.:..:|||.||...:....|   .|.:|. 
  Rat    36 PEPQEGNTLPGE---WPWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGS- 96

  Fly    86 SRYRKDG-----ELFSVADLQVHENFNPKTMDYDIGIIRLT-----KNLTLSRKVKAIPINPERV 140
              .:::|     |...||.||:.:.:|..:...|:.:::||     ..|.|.:.....|.     
  Rat    97 --LKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPIVHTTLCLPQPTHHFPF----- 154

  Fly   141 AEGTYATIAGWGFKSMNG-------------------------------------PPSDSLRYAR 168
              |......||...:.:|                                     |.|.:||..|
  Rat   155 --GASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLR 217

  Fly   169 VPIVNQTAC--------RNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQ-----LVGIV 220
            :.::::..|        :.||.......|||.|...|....||.|||||:..||.     .|||:
  Rat   218 LRLISRPTCNCLYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGII 282

  Fly   221 SWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
            |:...||..|.|.:.:.:.|...||...::::
  Rat   283 SFTSNCAQEDTPVLLTDMAAHSSWLQAHVDRA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 64/279 (23%)
Tryp_SPc 28..248 CDD:238113 66/282 (23%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 66/277 (24%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.