DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and betaTry

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286314.1 Gene:betaTry / 47901 FlyBaseID:FBgn0010357 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:99/256 - (38%)
Similarity:141/256 - (55%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCL-------SLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66
            |:||.|..|.       .|..:.|.|||||....|::.|:.:|:|..|.|.|||||.:...|:||
  Fly     5 LILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSIYSARVIVTA 69

  Fly    67 GHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK 131
            .|||..|....|::: .|:|.:...|.:..|:..:.||.:|..||..||.::.|:.:|:.|..:|
  Fly    70 AHCLQSVSASSLQIR-AGSSYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVLHLSSSLSFSSTIK 133

  Fly   132 AIPINPERVAEGTYATIAGWGFKSMNGPPS--DSLRYARVPIVNQTACRNL---LGKTVTDRMLC 191
            ||.:.....|.|..|:::|||.:| :|..|  ..|||..|.||:|:.|.:.   .|..:...|:|
  Fly   134 AIGLASSNPANGAAASVSGWGTES-SGSSSIPSQLRYVNVNIVSQSRCSSSSYGYGNQIKSSMIC 197

  Fly   192 AGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
            |  ...|.|:||.||||||.....|||:||||.|||.|:.||||:.:.||..|   |:|.:
  Fly   198 A--FASGKDSCQGDSGGPLVSGGVLVGVVSWGYGCAAANYPGVYADVAALRSW---VINNA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 89/221 (40%)
Tryp_SPc 28..248 CDD:238113 89/224 (40%)
betaTryNP_001286314.1 Tryp_SPc 30..249 CDD:214473 90/225 (40%)
Tryp_SPc 31..252 CDD:238113 90/227 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443364
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.