DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and intr

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:192 Identity:42/192 - (21%)
Similarity:71/192 - (36%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGGSIINNHTILTAGHC----LNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDY 113
            |.|::|:...:||:..|    |...|.|..|::   .||.|    ::|||:|..           
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQ---ASRSR----IYSVANLIT----------- 159

  Fly   114 DIGIIRLTKNLTLSRKVKAIPINPERVAEG---------TYATIAGWGFKSMNGPPSDSLRYARV 169
              |.|.....|.|...::...::|..:.|.         .|.:             ...||:.|.
  Fly   160 --GAIEDMALLLLHAPLEDPFVHPIDLCESPLRRNDNVTMYMS-------------QQHLRFLRT 209

  Fly   170 PIVNQTACRNLLGKT----VTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCA 227
            .::..:.|:....:.    :|..||||.......| ||...|..|..:::|.|:..:|..|:
  Fly   210 KLIPNSNCKRSYAQDENAFITQTMLCALNSNRLVD-CQTAKGDVLLHQDRLCGVDIYGQHCS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 42/192 (22%)
Tryp_SPc 28..248 CDD:238113 42/192 (22%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 42/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.