DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG34129

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:189 Identity:48/189 - (25%)
Similarity:82/189 - (43%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKDGELFSVAD-LQVHENFNPKTMDYDIG 116
            ||.:......::|:.:|:....:.|....|.||:....|.|.::..| :|..|.|..:.:..|:.
  Fly    68 CGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVA 132

  Fly   117 IIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGP-PSDSLRYARVPIVNQTACR-N 179
            ::|| ::....|..:.|.:...:|.......:.||||.:.... ||...|...|.|::...|| .
  Fly   133 VVRL-RDPVRGRLTEFIRLCSVKVQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKECRQK 196

  Fly   180 LLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRL 238
            .....:....:||...| ....|..|.|.||....:|.|:||:|..|....:||:|:.:
  Fly   197 FKSPKIASTSICARQPK-NPKQCLYDGGSPLIYGRELCGVVSFGSHCIDTSRPGMYTNI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 48/189 (25%)
Tryp_SPc 28..248 CDD:238113 48/189 (25%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 48/189 (25%)
Tryp_SPc 55..261 CDD:304450 48/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.