DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG15498

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:145 Identity:34/145 - (23%)
Similarity:51/145 - (35%) Gaps:43/145 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRY---ARVPIVNQTACRNL 180
            |.:.||.|.| .:|:   .:|..:||           :.|||.|.|.:   .::..|....||  
  Fly    29 RESGNLLLDR-TRAV---YDRFYQGT-----------VLGPPQDVLAFGVVVQIRPVKIGVCR-- 76

  Fly   181 LGKTVTDRMLCAGYL----------KGGTDACQMD-SGGPLSVREQLVGIVSWGVGCALADKPGV 234
              :.|:|:.|....:          |...:.|.:. :..|.........|||....    |:.|.
  Fly    77 --QQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPRPALRNSFRIVSPNED----DRTGQ 135

  Fly   235 Y------SRLDALHP 243
            |      .||.||.|
  Fly   136 YLAYGEKFRLQALEP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 34/145 (23%)
Tryp_SPc 28..248 CDD:238113 34/145 (23%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.