DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG5255

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:238 Identity:70/238 - (29%)
Similarity:108/238 - (45%) Gaps:20/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLY--GIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYR 89
            |||||..|.....||.:|:|..  |.|.|||:||:...|:||.||..|......:| :.||....
  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRV-LTGTQDLH 92

  Fly    90 KDGELFSVADLQV-HENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGF 153
            ::|..:...|..| |.|:.|:....||.::.|.:::......:.:.::.|.:..|:...:.|||.
  Fly    93 QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGT 157

  Fly   154 KSMNGPPSDSLRYARVPIVNQTACRNL--------LGKTVTDRMLCAGYLKGGTDACQMDSGGPL 210
            .|:.|.....|:...|..|....||..        :|...|       :...|..||..||||||
  Fly   158 LSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-------FNDKGRGACHGDSGGPL 215

  Fly   211 SVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKSK 253
            ....:||.:|:||:.|| ...|..::.:...|.::...|:.||
  Fly   216 VHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFIRTHLSLSK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 67/227 (30%)
Tryp_SPc 28..248 CDD:238113 66/230 (29%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/228 (29%)
Tryp_SPc 30..252 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.