DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG5246

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:239 Identity:71/239 - (29%)
Similarity:118/239 - (49%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RPDPRIVGGFPADIANIPYIVSI-QLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTS 86
            :|:.|::||..:.....||.||| ..:|.|.||||||....||||.||:.. |.:.||: |.||.
  Fly    37 KPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEW-PIQYLKI-VTGTV 99

  Fly    87 RYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLT---LSRKVK-----AIPINPERVAEG 143
            .|.:.|..:.|...::|.:.:......||.:|...|.:.   |::.:|     ::|      ..|
  Fly   100 DYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLP------KVG 158

  Fly   144 TYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLL--GKTVTDRMLCAGYLKGGTDACQMDS 206
            ...|:.|||.....|..|..|:...:..::...|::.:  ...:::..:|. :.:.|..:|..||
  Fly   159 DKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEGEGSCHGDS 222

  Fly   207 GGPL-SVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            |||| ...:.|||:|:||..||:. .|.|:..:...|.|::|::
  Fly   223 GGPLVDANQTLVGVVNWGEACAIG-YPDVFGSVAYYHDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 68/228 (30%)
Tryp_SPc 28..248 CDD:238113 68/231 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 68/229 (30%)
Tryp_SPc 42..263 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.