DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG17475

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:230 Identity:70/230 - (30%)
Similarity:110/230 - (47%) Gaps:12/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQ-LYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRK 90
            |::.|....:....|.:|:| :||.|.|||.||:...:|||.||:.|.....|:| :.||..|.|
  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRV-ITGTVEYEK 112

  Fly    91 DGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKS 155
            ...::.|.:..:|.|:|......||.:|||...:..:...:...:....||.||...:.|||...
  Fly   113 PDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTE 177

  Fly   156 MNGPPSDSLRYARVPIVNQTACRNLLGKTVTDR--MLCAGYLKGGTDACQMDSGGPLSVREQLVG 218
            :.|...|.|:.|.:..|..:.|:.::....::.  .:|. ...||..||..||||||:....|.|
  Fly   178 LWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICT-LTTGGQGACHGDSGGPLTHNGVLYG 241

  Fly   219 IVSWGVGCALA---DKPGVYSRLDALHPWLDQVLN 250
            :|:||..|||.   ....||..|:    |:..:::
  Fly   242 LVNWGYPCALGVPDSHANVYYYLE----WIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 69/222 (31%)
Tryp_SPc 28..248 CDD:238113 69/225 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 69/223 (31%)
Tryp_SPc 50..269 CDD:238113 69/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.