DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG10405

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:260 Identity:95/260 - (36%)
Similarity:139/260 - (53%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGC-LSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72
            |::|:||.. .::..:||.|||.|..|.....||.:|::...:|.||.||::::..:||.||::|
  Fly    17 LVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDG 81

  Fly    73 VPH----RLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKV-KA 132
              |    |...::.|...| ...|.:..|..:..|..::...|::|:.::| |.:..||..: |.
  Fly    82 --HEQQPREFTLRQGSIMR-TSGGTVQPVKAIYKHPAYDRADMNFDVALLR-TADGALSLPLGKV 142

  Fly   133 IPIN----PERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRNLLGK--TVTDRML 190
            .||.    .|.::|...|.::|||..|.:.|. |..|:...|..|||..|.|.|..  .||:.|.
  Fly   143 APIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMF 207

  Fly   191 CAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHP----WLDQVLNK 251
            ||.  ...|||||.|||||:|.:..|:||||||||||....||||:||  .||    |: ::|.|
  Fly   208 CAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRL--AHPTIRRWI-RLLTK 267

  Fly   252  251
              Fly   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 86/232 (37%)
Tryp_SPc 28..248 CDD:238113 86/235 (37%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 86/233 (37%)
Tryp_SPc 37..263 CDD:238113 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.