DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG12951

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:72/237 - (30%)
Similarity:115/237 - (48%) Gaps:14/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLY-GIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRK 90
            |:|.|..:.:...|::||::.| |.|.||||||:.|.::||.||.||.|...|.::.|.|:....
  Fly    29 RVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAM 93

  Fly    91 DGELFSVADLQVHENFNPKTMD-YDIGIIRLTKNLTLSRKVKAIPINPERVA-------EGTYAT 147
            ...:..:..:..||:|:|...: .||.::.:.:..... .|...|:....:|       .|....
  Fly    94 GPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFD-GVSVAPVELPALAFAVPQSDAGVEGV 157

  Fly   148 IAGWGFKSMNGPPSDSLRYARVPIVNQTACRNL-LGKTVTDRMLCAGYLKGGTDACQMDSGGPLS 211
            :.|||.....|...|:|:...:.|.:...|.:. .|:|.....:|.|..:||...|..||||||.
  Fly   158 LIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVDEGGKGQCSGDSGGPLI 222

  Fly   212 VREQLVGIVSWGV-GCALADKPGVYSRLDALHPWL--DQVLN 250
            ...|.||||||.: .|.:|..||||.::.....|:  :|:::
  Fly   223 YNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/227 (31%)
Tryp_SPc 28..248 CDD:238113 70/232 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 70/228 (31%)
Tryp_SPc 30..260 CDD:238113 70/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.