DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:242 Identity:77/242 - (31%)
Similarity:121/242 - (50%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SGCLSLESRP-DPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHC-LNGVPHRL 77
            |||......| ..::.||..|:....|:..|:|...:|.||.::|:|..::||.|| :.....:.
  Rat   173 SGCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSANPKD 237

  Fly    78 LKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK--AIPINPERV 140
            .||..|  ....|.....:|..:.:|||::....:.||.::||:..:.....::  .:|...::.
  Rat   238 WKVSFG--FLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKF 300

  Fly   141 AEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRN--LLGKTVTDRMLCAGYLKGGTDACQ 203
            ...:...:.|||....:|...:.|:..||.|::...|.:  ..|..:|..|||||:|:|..||||
  Rat   301 PPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFLEGRVDACQ 365

  Fly   204 MDSGGPLSVREQ-----LVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            .||||||...:.     |.||||||..|||.:|||||:|:.....|:
  Rat   366 GDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 72/226 (32%)
Tryp_SPc 28..248 CDD:238113 73/228 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 72/227 (32%)
Tryp_SPc 187..415 CDD:238113 73/228 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.