DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk4

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:269 Identity:70/269 - (26%)
Similarity:108/269 - (40%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 W-WKL--LLLQASGCLSLESRPDPRIVGG--------------FPADIANIPYIVSIQLYGIHHC 53
            | |.|  |:|:.:|  |..|....||:.|              |..|.|             ..|
  Rat     9 WGWFLGYLILEVTG--SSASSISSRIIQGQDCLPHSQPWQAALFSEDNA-------------FFC 58

  Fly    54 GGSIINNHTILTAGHCLN-------GVPHRLLKVKVGGTSRYRKDGELFSVADLQV-HENFNPKT 110
            .|.:::...:|:|.||:.       |: |.|        ...::.|.....|.|.: |.|:|..:
  Rat    59 SGVLVHPQWVLSAAHCIQDSYTVGLGL-HNL--------EGSQEPGSRMLEAHLSIQHPNYNDPS 114

  Fly   111 MDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQT 175
            ...|:.:|:|.:::..|..::.||:..:....|....::||| :..||.....|:...:.:.::.
  Rat   115 FANDLMLIKLNESVMESNTIRRIPVASQCPTPGDTCLVSGWG-RLKNGKLPSLLQCVNLSVASEE 178

  Fly   176 ACRNLLGKTVTDRMLCAGYLKGG---TDACQMDSGGPLSVREQLVGIVSWGVG-CALADKPGVYS 236
            .||.|........|.|||   ||   .|.|..|||||:.....|.|:||.|.| |.....|.||:
  Rat   179 TCRLLYDPVYHLSMFCAG---GGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYT 240

  Fly   237 RLDALHPWL 245
            .|.....|:
  Rat   241 NLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 61/242 (25%)
Tryp_SPc 28..248 CDD:238113 61/244 (25%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 59/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.