DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG10587

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:250 Identity:78/250 - (31%)
Similarity:125/250 - (50%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RP--DPRIVGGFPADIANI-PYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVK--- 81
            ||  ..|:|||.....|.: .|:::::......|||:::::..:|||.||..|      :||   
  Fly    39 RPGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLG------RVKISD 97

  Fly    82 ---VGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEG 143
               |||.|:....|....|.::.....|....|:.|:.|:||.|.:. .:.:..:.:..:::..|
  Fly    98 WLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPMK-GKSLGQLILCKKQLMPG 161

  Fly   144 TYATIAGWGF-KSMNGPPSDSLRYARVPIVNQTACR--------------NLLGKT-VTDRMLCA 192
            |...::|||. ::....|...||...||:|::..||              :|..|. :||.|.||
  Fly   162 TELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCA 226

  Fly   193 GYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQ 247
            |.| |..|||..||||||..:.|:.||||:|:|||.....|||:.:..:.|:::|
  Fly   227 GVL-GKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 74/239 (31%)
Tryp_SPc 28..248 CDD:238113 74/242 (31%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 75/240 (31%)
Tryp_SPc 46..280 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.