DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG32271

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:251 Identity:84/251 - (33%)
Similarity:134/251 - (53%) Gaps:8/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYKLWWKLLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66
            |..||..|.|:..  |.:..:..:.|||||.|.|||::||:|::::.|...||||::....::||
  Fly     1 MATLWLVLHLIPL--CWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTA 63

  Fly    67 GHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVK 131
            .||:.|:....:.| |.|.:|..:.|....|..:...:.:|.:|:..|:.:::|...:: ..||.
  Fly    64 AHCVKGIGASRILV-VAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVS 126

  Fly   132 AIPINPERVAEGTYATIAGWG-FKSMNGPPSDSLRYARVPIVNQTACRN--LLGKTVTDRMLCAG 193
            .|.:.......|....::||| ....|...|..:|...|.::.:.||.:  .|..|:|:.|.||.
  Fly   127 TIELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS 191

  Fly   194 YLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
             :.|..|||:.|||||...:.||.||||||||||....||||:.:..:..::|:.|
  Fly   192 -VPGVKDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 76/219 (35%)
Tryp_SPc 28..248 CDD:238113 76/222 (34%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 76/220 (35%)
Tryp_SPc 25..244 CDD:238113 75/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.