DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG32833

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:232 Identity:67/232 - (28%)
Similarity:116/232 - (50%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKDGE 93
            :||.|.:|...|:|.||.:.....|.|:|.....|:|||.|::|..:::::|:||.|:  |.||.
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTT--RSDGV 101

  Fly    94 L-FSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWG----- 152
            : .:|.::.|||.|..:|:.:::.|::|.:.|..|:.::.|.:..:..:.|...|..||.     
  Fly   102 IEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWW 166

  Fly   153 ---FKSMNGPPSDSLRYARVPIVNQTACRNLLG------KTVTDRMLCAGYLKGGTDACQMDSGG 208
               :|......:..|:.|.|.::..:.|.:|..      |..||.:.|..  |...:||.:..|.
  Fly   167 AMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTE--KFAKEACSLAMGS 229

  Fly   209 PLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            |:....:||||::.| ||  ::.|.||..|.....||
  Fly   230 PVVHNGKLVGIITKG-GC--SEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 65/229 (28%)
Tryp_SPc 28..248 CDD:238113 67/232 (29%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 67/231 (29%)
Tryp_SPc 40..262 CDD:214473 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.