DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss56

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:240 Identity:89/240 - (37%)
Similarity:129/240 - (53%) Gaps:12/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTS 86
            :|...|||||..|.:...|::|.:||.|:..|||.::....:|||.||..|..:.||...:....
  Rat   106 TRAHGRIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEG 170

  Fly    87 RYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAE---GTYATI 148
            ...:..|...|..:..|..|:|:|...|:.:::|...:......:.|.: ||...|   ||..||
  Rat   171 PQGEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVNSEGPARPICL-PEGSREPPAGTPCTI 234

  Fly   149 AGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVT-DRMLCAGYLKGGTDACQMDSGGPLSV 212
            ||||....:||.|:::|.||||:::...|:..||..:: ..|||||||.||.|:||.||||||:.
  Rat   235 AGWGALFEDGPESEAVREARVPLLSADTCQKALGPGLSPSTMLCAGYLAGGIDSCQGDSGGPLTC 299

  Fly   213 -------REQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLN 250
                   ||.|.|:.|||.||....|||||:|:.....||.:.::
  Rat   300 SEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQEQMS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 86/227 (38%)
Tryp_SPc 28..248 CDD:238113 87/230 (38%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.