DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss3

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:230 Identity:80/230 - (34%)
Similarity:126/230 - (54%) Gaps:12/230 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVG--GTSR 87
            |.:||||:.....::||.||:. .|.|.||||:||:..:::|.||..    ..::|::|  ..:.
  Rat    21 DDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYK----TRIQVRLGEHNINV 80

  Fly    88 YRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWG 152
            ...|.:..:.|.:..|.|||.:.::.||.:|:|:..:.|:.:|..:.:.......||...|:|||
  Rat    81 LEGDEQFVNAAKIIKHPNFNARNLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWG 145

  Fly   153 ---FKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVRE 214
               ...:|.|  |.|:....|::.|..|.......:|:.|:|.|:|:||.|:||.|||||:....
  Rat   146 NTLSLGVNNP--DLLQCLDAPVLPQADCEASYPGKITNNMICVGFLEGGKDSCQGDSGGPVVCNG 208

  Fly   215 QLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            ||.||||||.||||.|.||||:::.....|:...:
  Rat   209 QLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 78/221 (35%)
Tryp_SPc 28..248 CDD:238113 79/224 (35%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 78/222 (35%)
Tryp_SPc 24..242 CDD:238113 79/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.