DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and zetaTry

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:249 Identity:103/249 - (41%)
Similarity:142/249 - (57%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSLESRPDPRIVGGFPADIANIPYIVSIQLYGI--------HHCGGSIINNHTILTAGHCLNGVP 74
            |..:|.||.|||||:..|||.:||.:|::..||        |.|||||.|..||:||.||:.|..
  Fly    29 LDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTV 93

  Fly    75 HRLLKVKVGGTSRYRKDGELFSVADLQVHEN-FNPKTMDYDIGIIRLTKNLTLSR-KVKAIPINP 137
            ....||..|...:...||.:.:|.::.:||. ::....:.||.|:.:...|.|:. .:|||.:..
  Fly    94 ASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLAL 158

  Fly   138 ERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTAC----RNLLGKT--VTDRMLCAGYL- 195
            |:..|||.:.::|||..|..|..|:.|....||||:...|    .:...:|  :|..|||||.. 
  Fly   159 EQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRG 223

  Fly   196 KGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVL 249
            .||.||||.||||||:||::|.|:||||..|||.:.||||:.:..|.||:|.||
  Fly   224 VGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 94/233 (40%)
Tryp_SPc 28..248 CDD:238113 96/236 (41%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 95/234 (41%)
Tryp_SPc 39..276 CDD:238113 96/236 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.