DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss21

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:265 Identity:76/265 - (28%)
Similarity:127/265 - (47%) Gaps:64/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKD 91
            |||||..|::...|:..|::::|.|.||.:::|...:|||.||                  ::||
  Rat    57 RIVGGEEAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHC------------------FQKD 103

  Fly    92 GELF-------------SVADLQVHEN--------FNPKTMD---YDIGIIRLTKNLTLSRKVKA 132
            .:.|             |:.:||.:.|        .:||..:   :||.:::|:..:|.|..::.
  Rat   104 NDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYTEQFPHDIALLKLSSPVTYSNFIQP 168

  Fly   133 IPI--NPERVAEGTYATIAGWGF--KSMNGPPSDSLRYARVPIVNQTACRNLLGK-----TVTDR 188
            |.:  :..:.|..|...:.|||.  :..:.|..::|:..:|.|:|.|.|.:|..|     .:...
  Rat   169 ICLLNSTYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGD 233

  Fly   189 MLCAGYLKGGTDAC---------QMDSGGPLSVREQL----VGIVSWGVGCALADKPGVYSRLDA 240
            |:|||..:||.|||         |.||||||...:..    ||:||||:||...::||||:.:..
  Rat   234 MVCAGSPEGGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGIGCGRPNRPGVYTNISH 298

  Fly   241 LHPWL 245
            .:.|:
  Rat   299 HYNWI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 75/262 (29%)
Tryp_SPc 28..248 CDD:238113 75/264 (28%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 75/263 (29%)
Tryp_SPc 58..304 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.