DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Prss33

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:272 Identity:94/272 - (34%)
Similarity:137/272 - (50%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLLQASG-----CLSL-ESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTA 66
            ::|||...|     |.:. :.|...|||||..|.....|:..|||..|.|.||||:|....:|||
Mouse    72 QILLLLVLGTRMQECAACGQPRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTA 136

  Fly    67 GHCLNGVPHRL----LKVKVGGTS-RYRKDGELF-SVADLQVHENFNPKTMDYDIGIIRLTKNLT 125
            |||.   |.|:    ..|.:|..| ..|...||. .|..:.:..:::......|:.:::|...::
Mouse   137 GHCF---PRRVWPSEYSVLLGALSLDVRSSHELLVPVLRVLLPPDYSEDEARGDLALLQLRHPVS 198

  Fly   126 LSRKVK--AIPINPERVAEGTYATIAGWGFKS--MNGPPSDSLRYARVPIVNQTACRNL--LGKT 184
            ||.:::  .:|........|:...:.|||..|  :..|....|:..|||:::..||..|  :|..
Mouse   199 LSTRIQPVCLPAPGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHVGAN 263

  Fly   185 VT--DRM-----LCAGYLKGGTDACQMDSGGPLSVREQ----LVGIVSWGVGCALADKPGVYSRL 238
            |.  :|:     |||||.:|..||||.||||||:..|.    |||:||||.||||.::||||:.:
Mouse   264 VPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLTCMESGHWVLVGVVSWGKGCALPNRPGVYTNV 328

  Fly   239 DALHPWLDQVLN 250
            ....||:...|:
Mouse   329 AKYSPWIQARLS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 85/239 (36%)
Tryp_SPc 28..248 CDD:238113 86/242 (36%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.