DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Send2

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:128/253 - (50%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQASGCLSLES--RPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72
            |||.|...||...  ||:.||:||.|..|...|:.||||..|.|.|||||.:...|:||.||:.|
  Fly     7 LLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQG 71

  Fly    73 VPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINP 137
            ..:::.    .|::....:|.:..||.::.||.     :..||.|:||:|.|..:.:|:.||:..
  Fly    72 QGYQVR----AGSALKNSNGSVVDVAAIRTHEG-----LGNDIAIVRLSKPLEFTNQVQPIPLAK 127

  Fly   138 ERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDAC 202
            .....|:.|.::|||..|....|.| |:...:.|.....|    |.|...| :|||..  |..||
  Fly   128 TNPPPGSIAFVSGWGSSSYYSHPID-LQGVNLYIQWPYYC----GLTEPSR-ICAGSF--GRAAC 184

  Fly   203 QMDSGGPLSVREQLVGIVSWGV-GCALADKPGVYSRLDALHPW----LDQVL--NKSK 253
            :.||||||...:||||:||.|. .|..:   .:|:.:.....|    :|:::  |::|
  Fly   185 KGDSGGPLVFDQQLVGVVSGGTKDCTYS---SIYTSVPYFREWILNAIDEIMSANRNK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 75/217 (35%)
Tryp_SPc 28..248 CDD:238113 76/224 (34%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 75/218 (34%)
Tryp_SPc 27..225 CDD:238113 74/217 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.