DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Phae1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:254 Identity:84/254 - (33%)
Similarity:121/254 - (47%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASGCLSL----------ESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGH 68
            |||.|.|          ...|:.|:|||.||.:.:.||.||:|..|.|:|..||:|.:.::||.|
  Fly    12 ASGLLLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAH 76

  Fly    69 CLNGVPHRLLKVKVGGTSRYRKDG-----ELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSR 128
            ||......|....|.|:  ...||     :..|:....:::.:...|:.||||:|........|.
  Fly    77 CLTNSNQVLGSTLVAGS--IAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSA 139

  Fly   129 KVKAIPINPERVAEGTYATIAGWGFKSMNGPPS--DSLRYA-RVPIVNQTACRNLLGKTVTD--- 187
            .|..:.:....|.....|.:.|||..|.....|  .:|:.| .|||::.::|.:.||...:|   
  Fly   140 AVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHS 204

  Fly   188 RMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWG-VGCALADKPGVYSRLDALHPWL 245
            ..||.|.|.||...|..||||||.....|:|||||| :.|..|:.|.||.::.:...|:
  Fly   205 TNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 77/228 (34%)
Tryp_SPc 28..248 CDD:238113 77/230 (33%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 77/229 (34%)
Tryp_SPc 36..266 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.