DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and PRSS48

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:250 Identity:68/250 - (27%)
Similarity:119/250 - (47%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLN------GVPHRLLKVKVGGT 85
            |:|||..|.....|:.||:.......||||:::...||||.||:.      .....|..:.||.:
Human    50 RVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVGDS 114

  Fly    86 SRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAI--PINPERVAEGTYATI 148
            .:..|    :.|:.:.:|..:...|.  |:.:::|:..:|.:..:..|  |...:::|...:..:
Human   115 RKRVK----YYVSKIVIHPKYQDTTA--DVALLKLSSQVTFTSAILPICLPSVTKQLAIPPFCWV 173

  Fly   149 AGWG--FKSMNGPPSDSLRYARVPIVNQTACRNL----------LGKTVTDRMLCAGYLKGGTDA 201
            .|||  .:|.:.....:|:.|.|||:::.||..|          |...:.:..:|||..:...|:
Human   174 TGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDS 238

  Fly   202 CQMDSGGPLSVREQLV----GIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
            |:.|||||||.....|    |:||||:.|. ...||||:.:.....|::..::::
Human   239 CKGDSGGPLSCHIDGVWIQTGVVSWGLECG-KSLPGVYTNVIYYQKWINATISRA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 67/240 (28%)
Tryp_SPc 28..248 CDD:238113 67/243 (28%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 67/241 (28%)
Tryp_SPc 51..288 CDD:238113 67/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.