DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG31954

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:263 Identity:104/263 - (39%)
Similarity:140/263 - (53%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQASGCL---------SLES----------RPDPRIVGGFPADIANIPYIVSIQLYGIHHCGG 55
            ||:.|..||         |||.          |.|.|||||...:|.:.|:.||:|. ..|.|||
  Fly    14 LLVLAGVCLIPQPVKRQRSLEDVIKNPWKLSPRLDGRIVGGHRINITDAPHQVSLQT-SSHICGG 77

  Fly    56 SIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRL 120
            |||:...||||.||..|.....|||:: |||.:.:.|:|..|..:..|..||...:|||..:::|
  Fly    78 SIISEEWILTAAHCTYGKTADRLKVRL-GTSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQL 141

  Fly   121 TKNLTLSRKVKAIPINPE---RVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLG 182
            ...:......||:.: ||   :..:|....::|||.........:.||...||:|||..|.....
  Fly   142 AHPIKFDETKKAVKL-PESQMKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYK 205

  Fly   183 K--TVTDRMLCAGYLKGGTDACQMDSGGPL-SVREQLVGIVSWGVGCALADKPGVYSRLDALHPW 244
            :  .||:||:|||:|:||.||||.|||||: |...:|||:||||.|||..|.||||||:.....|
  Fly   206 QYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDW 270

  Fly   245 LDQ 247
            :.:
  Fly   271 IKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 93/222 (42%)
Tryp_SPc 28..248 CDD:238113 93/226 (41%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 93/223 (42%)
Tryp_SPc 51..274 CDD:238113 93/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.