DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG11911

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:240 Identity:71/240 - (29%)
Similarity:120/240 - (50%) Gaps:26/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGFPADIANIPYIVSI---QLYGIHHCGGSIINNHTILTAGHCLN---GVPHRLLKVKVGGTS 86
            ::.|..|:..:.|||||:   .|...|.|||::||...|:||.||::   |     :.:..|..:
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVG-----MSIIAGLHT 96

  Fly    87 RYRKDGELFSVADL---QVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPI-NPERVAEGTYAT 147
            |...| ||.....:   :|||.:......|||.::.:.::...:..|:...: :.|:|.||. ..
  Fly    97 RAEVD-ELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGE-TH 159

  Fly   148 IAGWGF-KSMNGPPSDSLRYARVPIVNQTACRNLLGKT--VTDRMLCAGYLKGGTDACQMDSGGP 209
            :.|||. ||.....:.:|:.....|:|...|:..|.::  :.:..:|:..|:....||..|||||
  Fly   160 LYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGP 224

  Fly   210 LSVR-----EQLVGIVSWG-VGCALADKPGVYSRLDALHPWLDQV 248
            |.|.     .:|:|||||| :.|.||:.|.:|:::.|...|:..:
  Fly   225 LVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/234 (30%)
Tryp_SPc 28..248 CDD:238113 71/238 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/238 (30%)
Tryp_SPc 37..266 CDD:214473 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.