DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG1304

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:111/249 - (44%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRP---DPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCL 70
            ||||    .:.:.|.|   :.|:|||..|.....|:.||::..|.|.|||||::.:.:|||.||:
  Fly    14 LLLL----AVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCV 74

  Fly    71 -------NGVP--HRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTL 126
                   |.||  .....::.|...|: ..|.|..||::.|||.:.  ....|:.::||...|.|
  Fly    75 TNQDSNGNSVPIAAERFTIRAGSNDRF-SGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLIL 136

  Fly   127 SRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLC 191
            |..::.|.:............|:|||.....|.....|:|..:..::...|..|:|..|... ||
  Fly   137 SASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSE-LC 200

  Fly   192 AGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALHPWL 245
            ..: :....||..|||||.....|:||:..:.........|..|:|:...:.|:
  Fly   201 LIH-EADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 65/225 (29%)
Tryp_SPc 28..248 CDD:238113 65/227 (29%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/226 (29%)
Tryp_SPc 32..256 CDD:238113 65/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.