DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG4653

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:232 Identity:63/232 - (27%)
Similarity:111/232 - (47%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLN------GVPHRLLKVKVGGTSRYRKD 91
            ||::.:.|:.:|::..|:|.|||::|....||||.||::      ..|.:...|:||...|. ..
  Fly    30 PAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRL-TG 93

  Fly    92 GELFSVADLQVHENFNPKTM--DYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFK 154
            |:|..::.:.:|.|::....  ..|:.::.|..::.|:.....|.:..||.|.|:....:|||..
  Fly    94 GQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSS 158

  Fly   155 SMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLC--------AGYLKGGTDACQMDSGGPLS 211
            .::|..|..|:.|....::.:.|:..|.....| :||        ||       .|..|:|.|.|
  Fly   159 QVDGSLSHVLQVATRQSLSASDCQTELYLQQED-LLCLSPVDEDFAG-------LCSGDAGAPAS 215

  Fly   212 VREQLVGIVSWGV-GCALADKPGVYSRLDALHPWLDQ 247
            ...|||||.::.| ||. :::|..|..:.....|:::
  Fly   216 YNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 62/227 (27%)
Tryp_SPc 28..248 CDD:238113 63/232 (27%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/232 (27%)
Tryp_SPc 30..249 CDD:214473 62/228 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.