DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG9673

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:245 Identity:61/245 - (24%)
Similarity:114/245 - (46%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG-----VPHRL 77
            ||.|:.|..||:||........|:..|::....|.|.|:||:.:.||||.||::.     |....
  Fly    19 LSAEASPQGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVGITPVDAST 83

  Fly    78 LKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINP----- 137
            |.|::|..::| ..|.:.:|..:.:|.::.  ...:||.|:.|.:.|..|.:::.|.:.|     
  Fly    84 LAVRLGTINQY-AGGSIVNVKSVIIHPSYG--NFLHDIAILELDETLVFSDRIQDIALPPTTDEE 145

  Fly   138 -----ERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKG 197
                 ..:..||...:||||..| :|..|...:.|....::::.|....|... :.::|....: 
  Fly   146 TEDVDAELPNGTPVYVAGWGELS-DGTASYKQQKANYNTLSRSLCEWEAGYGY-ESVVCLSRAE- 207

  Fly   198 GTDACQMDSGGPLSVREQLV-GIVSWGVGCALADKPGVYSRLDALHPWLD 246
            |...|:.|:|..:...:::: |:.|:..|...:..|.|.:|:.....|::
  Fly   208 GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 56/232 (24%)
Tryp_SPc 28..248 CDD:238113 56/235 (24%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 56/233 (24%)
Tryp_SPc 29..259 CDD:238113 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.