DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and sphe

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:232 Identity:66/232 - (28%)
Similarity:114/232 - (49%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHR--------LLKVKVG 83
            ||:||..||.....:..|:::...|.|||||::...|||..||:    ||        .|..:||
  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCV----HRDGKLIDASRLACRVG 85

  Fly    84 GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPI--NPERV-AEGTY 145
            .|::| ..|::.:|..:.||.::  ..::.::.:|.|:..||.:.::.|||:  :.|.: |||:.
  Fly    86 STNQY-AGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSE 147

  Fly   146 ATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPL 210
            ..:|||| ::.:|..|..:|...:.:..:..|.:............|..||.||  |..|.||..
  Fly   148 VIVAGWG-RTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGT--CHGDGGGGA 209

  Fly   211 SVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQ 247
            .....|:|:.::.||...:..|.|:.||.:...|:.:
  Fly   210 IYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 65/227 (29%)
Tryp_SPc 28..248 CDD:238113 65/231 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/215 (28%)
Tryp_SPc 42..244 CDD:214473 59/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.