DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG9676

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:250 Identity:83/250 - (33%)
Similarity:132/250 - (52%) Gaps:11/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYKLWWKLLLLQASGCLSL-ESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILT 65
            |...|..||:|.|:|.|:. :|..:||||||..|.....|:.:|::..|.|.||||||:...::|
  Fly     1 MLPFWTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVT 65

  Fly    66 AGHCL----NGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTL 126
            |.||:    |..|...|::: .|:......|....||.:.||.|:|  :..:|:.::||..:||.
  Fly    66 AAHCVKQGNNVAPANELEIQ-AGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTF 127

  Fly   127 SRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLGKTVTDRMLC 191
            :..:.||.:..|.........|:|||..|..||.|:||.|.:|..:::.:|:....:.:.:..:|
  Fly   128 NSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMC 192

  Fly   192 AGYLKGGTDACQMDSGGPLSVREQLVGIVSWGV-GCALADKPGVYSRLDALHPWL 245
            ..:.| ...||..|||||.:.:.:|||:.|:.: ||..| .|..|.|:..|..|:
  Fly   193 LLHPK-DKGACYGDSGGPATYQGKLVGLASFVIGGCGRA-APDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 72/221 (33%)
Tryp_SPc 28..248 CDD:238113 72/222 (32%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 72/222 (32%)
Tryp_SPc 28..248 CDD:238113 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.