DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG31681

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:255 Identity:89/255 - (34%)
Similarity:127/255 - (49%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLQASG--CLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72
            :|:..:|  |.:....|:.|||||....|..:|:.||:|...:|.|||.|.::..||||.|||:.
  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73

  Fly    73 VPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMD-YDIGIIRLTKNLTLSRKVKAIPIN 136
            |....|.|: .|:|.:.|.|::..|.....|..:.||..: |||.::.|...|.|...||.||:.
  Fly    74 VTVTDLSVR-AGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLA 137

  Fly   137 PERVAEGTYATIAGWGFKSMNGP---PSDSLRYARVPIVNQTAC-RNLLGKTVTDRMLCAGYLKG 197
            .:....||....:|||:...|..   |  .|:...|.|:|:|.| :......:|..|:||...: 
  Fly   138 EQTPVAGTIVLTSGWGYTRENSSFLWP--ILQGVHVAILNRTDCLKAYKHVNITIDMICADGQR- 199

  Fly   198 GTDACQMDSGGPL-----SVREQLVGIVSWGVGCALADKPGVYSRLDALHPWLDQVLNKS 252
             .|.||.||||||     ....||:|:||||.||  ...||||..:...|.|:...:.|:
  Fly   200 -WDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGC--GTNPGVYEDIAFFHNWIKYTVKKN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 83/226 (37%)
Tryp_SPc 28..248 CDD:238113 83/229 (36%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 83/227 (37%)
Tryp_SPc 29..250 CDD:238113 83/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.