DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG32834

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:262 Identity:79/262 - (30%)
Similarity:122/262 - (46%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWWKLLLLQAS------GCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTI 63
            :|...|.|.|:      |.|..:|    ||:||:..||.:.||...:.:.|...|.|:||.:.||
  Fly     2 IWSVFLFLLAALLRPVRGDLDAQS----RIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTI 62

  Fly    64 LTAGHCLNGVPHRLLKVKVGGTSR-YRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLS 127
            :||..|:..  :..::|:||.:|| |...|.|..|.::..|..:|....|.::.:::|...|..|
  Fly    63 ITAASCVQS--YGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTS 125

  Fly   128 RKVKAIPINPERVAEGTYATIAGWGFKS--------MNGPPSDSLRYARVPIVNQTACR------ 178
            ..::.|.|..:...:|::.|::|||..|        ..|...|.|:.|.|.:.|:..|.      
  Fly   126 EAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAADRGVW 190

  Fly   179 -NLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVGCALADKPGVYSRLDALH 242
             .|....::...||.   ..|...|..|:|.||.:..|||||:|.| ||  ..||.||:.:    
  Fly   191 FGLWDNGISYLTLCT---HNGAGGCSYDTGAPLVIDGQLVGILSEG-GC--TTKPDVYANV---- 245

  Fly   243 PW 244
            ||
  Fly   246 PW 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/232 (30%)
Tryp_SPc 28..248 CDD:238113 71/233 (30%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 72/234 (31%)
Tryp_SPc 27..255 CDD:238113 71/233 (30%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.