DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and CG32523

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:260 Identity:83/260 - (31%)
Similarity:130/260 - (50%) Gaps:20/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYKLWWKLLLLQASGCLSL----------ESRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGS 56
            |:...|.:|||...|...:          ||..:||||||..|.....|:.:|::|.|.|:|||.
  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGV 65

  Fly    57 IINNHTILTAGHCL----NGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGI 117
            ||:...::|||||:    :.||..|..:: .|:.....||....||::.:|.|:.....: |:.:
  Fly    66 IISATHVITAGHCVKHGNDVVPADLWSIQ-AGSLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAV 128

  Fly   118 IRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPSDSLRYARVPIVNQTACRNLLG 182
            :||...||....:.||.:..|.........|:|||..:..||.||||.:.:|..:::.|||.:..
  Fly   129 LRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY 193

  Fly   183 KTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVS--WGVGCALADKPGVYSRLDALHPWL 245
            ..:.:.|:|..:.| .:.||..|||||.:...::||:.|  .|.||..| .|..|.|:..:..|:
  Fly   194 SRLPETMICLLHSK-NSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256

  Fly   246  245
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 73/222 (33%)
Tryp_SPc 28..248 CDD:238113 73/224 (33%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/223 (33%)
Tryp_SPc 37..219 CDD:238113 60/184 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.