DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk15

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:220 Identity:71/220 - (32%)
Similarity:113/220 - (51%) Gaps:18/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PYIVSIQLYGIHHCGGSIINNHTILTAGHCLNGVPHRLLKVKVGGTSRYRKDG--ELFSVADLQV 102
            |:.|::...|..:||..:|:...:|||.||..    |.::|::|..:..:.||  :|.||:.:..
Mouse    32 PWQVALFERGRFNCGAFLISPRWVLTAAHCQT----RFMRVRLGEHNLRKFDGPEQLRSVSRIIP 92

  Fly   103 HENFNPKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPS------ 161
            |..:..:|..:||.::||.|...|:..|:.:.:.......|....::|||..|.|.|.:      
Mouse    93 HPGYEARTHRHDIMLLRLFKPARLTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKS 157

  Fly   162 -----DSLRYARVPIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVS 221
                 |:|..|.:.|:::.:|.......|...|:|||...||||:|:.||||||.....|.||||
Mouse   158 HVRLPDTLHCANISIISEASCNKDYPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVS 222

  Fly   222 WG-VGCALADKPGVYSRLDALHPWL 245
            || |.|....|||||:::.:...|:
Mouse   223 WGDVPCDTTTKPGVYTKVCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/217 (32%)
Tryp_SPc 28..248 CDD:238113 71/220 (32%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 70/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.