DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk12

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:121/257 - (47%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLESRPDPRIVGGFPADIANIPYIVSIQLYGIHH-----CGGSIINNHTILTAGH 68
            ||||...| ||...|  .:|..|......:.|:.|     |:.|     |||.:::...:|||.|
  Rat     6 LLLLCVVG-LSQADR--EKIYNGVECVKNSQPWQV-----GLFHGKYLRCGGVLVDRKWVLTAAH 62

  Fly    69 CLNGV-----PHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNLTLSR 128
            |....     .|.|.|:.:  |.:.|.  ..||:.....|..:  :..::|:.::||.:.::|:.
  Rat    63 CSGKYMVRLGEHSLSKLDL--TEQLRL--TTFSITHPSYHGAY--QNHEHDLRLLRLNRPISLTY 121

  Fly   129 KVKAIPINPERVAEGTYATIAGWGFKSMNGPP-SDSLRYARVPIVNQTACRNLLGKTVTDRMLCA 192
            .|:.:.:.......|....|:|||..:....| .|.|:...:.||:...||.:....||:.||||
  Rat   122 AVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGRVTENMLCA 186

  Fly   193 GYLKGGTDACQMDSGGPLSVREQLVGIVSWG-VG-CALADKPGVYSRLDALHPWLDQVLNKS 252
            |. :.|.||||.||||||.....|.|:|||| || |.....||||:::.....|:..|:..:
  Rat   187 GG-EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWIRVVIRNN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 70/229 (31%)
Tryp_SPc 28..248 CDD:238113 71/232 (31%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 70/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.