DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:261 Identity:89/261 - (34%)
Similarity:127/261 - (48%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLQASGCLSLE-SRPDPRIVGGFPADIANIPYIVSIQLYGIHHCGGSIINNHTILTAGHCLNG 72
            ||||...||...: |....|||||..|.....|:..|::|..:|.||||:::...:|||.||.:|
  Rat    10 LLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCFSG 74

  Fly    73 VPHRLLKVKVGGTSRYRKD-GEL-------FS-VADLQVHENF-NPKTMDYDIGIIRLTKNLTLS 127
            ..:         :|.|... |||       || |..:.::.:. .|.....||.:::|...:.||
  Rat    75 SVN---------SSDYEVHLGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALS 130

  Fly   128 RKVKAIPINPERVAE---GTYATIAGWGFKSMNGP--PSDSLRYARVPIVNQTACRNLL----GK 183
            .:|:.:.: ||..|:   |....:.|||:.....|  |..:|:.|:|.:|:...|....    |.
  Rat   131 SQVQPVCL-PEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGS 194

  Fly   184 TVTDRMLCAGYLKGGTDACQMDSGGPLSVRE----QLVGIVSWGVGCALADKPGVYSRLDALHPW 244
            .:...||||.   |..||||.||||||..|.    |..|:||||.||...|:||||:|:.|...|
  Rat   195 LIQSDMLCAW---GPGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNW 256

  Fly   245 L 245
            :
  Rat   257 I 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 81/239 (34%)
Tryp_SPc 28..248 CDD:238113 81/241 (34%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 81/240 (34%)
Tryp_SPc 30..260 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.