DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk1c3

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:266 Identity:83/266 - (31%)
Similarity:133/266 - (50%) Gaps:33/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WKLLLLQASGCLSLESRP--DPRIVGGFPADIANIPYIVSIQLYGIHH--CGGSIINNHTILTAG 67
            |.|:|..|.....:::.|  ..|:||||..:..:.|:.|::    |:.  |||.:|:...::||.
  Rat     2 WFLILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAV----INEDLCGGVLIDPSWVITAA 62

  Fly    68 HCLNGVPHRLLKVKVGGTSRYRKDGELFSVADLQVHENFNP--------KTMDY--DIGIIRLTK 122
            ||.:...|.||     |.:...:|.:...|:....|.::.|        |..||  |:.::.|::
  Rat    63 HCYSDNYHVLL-----GQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLHLSE 122

  Fly   123 NLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPPS-----DSLRYARVPIVNQTACRNLLG 182
            ...::..||.|.:..:....|:...::|||  |.|  ||     |.|:...:.:::...|.....
  Rat   123 PADITDGVKVIDLPTKEPKVGSTCLVSGWG--STN--PSEWEFPDDLQCVNIHLLSNEKCIKAYK 183

  Fly   183 KTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWG-VGCALADKPGVYSRLDALHPWLD 246
            :.|||.|||||.|:||.|.|:.||||||.....|.||.||| |.|...:|||:|::|.....|:.
  Rat   184 EKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKFTSWIK 248

  Fly   247 QVLNKS 252
            :|:.|:
  Rat   249 EVMKKN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 75/234 (32%)
Tryp_SPc 28..248 CDD:238113 75/237 (32%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 75/235 (32%)
Tryp_SPc 25..250 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.