DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7829 and Klk11

DIOPT Version :9

Sequence 1:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:279 Identity:83/279 - (29%)
Similarity:124/279 - (44%) Gaps:43/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WKL-----------LLLQASGCLSLESRP--------DPRIVGGFPADIANIPYIVSIQLYGIHH 52
            |||           .||||...|...:..        :.||:.|:.....:.|:.|::.......
  Rat    11 WKLSTEPREPGARPALLQAMMILRFIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLL 75

  Fly    53 CGGSIINNHTILTAGHCLNGVPHRLLKV------KVGGTSRYRKDGELFSVADLQVHENFN---- 107
            ||.::|....:|||.||..  ||.::.:      |..|..:.|...|.|.      |..||    
  Rat    76 CGATLIAPKWLLTAAHCRK--PHYVILLGEHNLEKTDGCEQRRMATESFP------HPGFNNSLP 132

  Fly   108 PKTMDYDIGIIRLTKNLTLSRKVKAIPINPERVAEGTYATIAGWGFKSMNGPP---SDSLRYARV 169
            .|....||.:::::....::|.|:.:.::...|..||...|:|||  :.:.|.   ..|||.|.|
  Rat   133 NKDHRNDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWG--TTSSPQLRLPHSLRCANV 195

  Fly   170 PIVNQTACRNLLGKTVTDRMLCAGYLKGGTDACQMDSGGPLSVREQLVGIVSWGVG-CALADKPG 233
            .|:....|.......:||.||||...|.|.|:||.||||||.....|.||:|||.. ||:..|||
  Rat   196 SIIGHKECERAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPG 260

  Fly   234 VYSRLDALHPWLDQVLNKS 252
            ||:::.....|:.:|:..:
  Rat   261 VYTKVCKYFDWIHEVMRNN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 73/230 (32%)
Tryp_SPc 28..248 CDD:238113 73/233 (31%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 73/231 (32%)
Tryp_SPc 51..275 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.